PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G35960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 205aa    MW: 22421 Da    PI: 9.3533
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G35960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.3e-38101156459
           zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                      + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grrkn+
  ONIVA01G35960.1 101 APLPCPRCRSRDTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRKNR 156
                      5689**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.751103157IPR003851Zinc finger, Dof-type
PfamPF027014.1E-31103156IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-26103156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAPAAGGFKL FGKVIMQCGV SEGTQDKAQG FVVAREKVEP EEEEEEEQRV PAAATSGQRA  60
SIKREAADRD EEQRQGGGDA AGQPTQRRLQ DSAEARAAAA APLPCPRCRS RDTKFCYFNN  120
YNVNQPRHFC KACHRYWTAG GALRNVPVGA GRRKNRPLGP LAVAHHHHHH RAAAGFVLGF  180
PNPSSPTSPS PVYTDRWPVT PDRPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0710830.0AK071083.1 Oryza sativa Japonica Group cDNA clone:J023076F14, full insert sequence.
GenBankAP0034090.0AP003409.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1131G08.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630447.11e-150PREDICTED: cyclic dof factor 2
SwissprotQ8W1E35e-35CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A0E0FTE31e-151A0A0E0FTE3_ORYNI; Uncharacterized protein
STRINGLOC_Os01g55340.11e-149(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.13e-33Dof family protein